+44 (0) 1223 755950
+1 832 327 7413
Click on the image to see the image legend
Target | Acrp30 |
Origin | Human |
Expression | Recombinant |
Tested Applications | SDS-PAGE |
Conjugation | Unconjugated |
Form | Liquid |
Purity | > 90% (SDS-PAGE) |
UniProt Primary AC | Q15848 (UniProt, ExPASy) |
UniProt Secondary AC | Q58EX9 |
UniProt Entry Name | ADIPO_HUMAN |
KEGG | hsa:9370 |
String | 9606.ENSP00000389814 |
Sequence | MGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN. |
Activity | Not tested |
Availability | Shipped within 5-10 working days. |
Note | This product is for research use only. Not for human consumption, cosmetic, therapeutic or diagnostic use. |