+44 (0) 1223 755950
+1 832 327 7413
Click on the image to see the image legend
Target | Allograft Inflammatory Factor 1 (AIF1) |
Origin | Human |
Expression | Recombinant |
Tested Applications | SDS-PAGE |
Conjugation | Unconjugated |
Form | Lyophilized |
Purity | > 90% (SDS-PAGE) |
UniProt Primary AC | P55008 (UniProt, ExPASy) |
UniProt Secondary AC | A8K406, O43904, Q9UIV4, Q9UKS9 |
UniProt Entry Name | AIF1_HUMAN |
Gene Symbol | AIF1 |
GeneID | 199 |
OMIM | 601833 |
HGNC | 352 |
KEGG | hsa:199 |
Ensembl | ENSG00000204472 |
String | 9606.ENSP00000365227 |
Sequence | MKHHHHHHASQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP. |
Activity | Not tested |
Availability | Shipped within 5-10 working days. |
Note | This product is for research use only. Not for human consumption, cosmetic, therapeutic or diagnostic use. |