+44 (0) 1223 755950
+1 832 327 7413
Ataxin 1 (ATXN1) Antibody (FITC)
REQUEST MORE INFO
Catalogue No: abx443304
Price:
US$696.00
(Size: 100 µg)
Reviews: 
(0 Publications and Reviews)
(0 Publications and Reviews)
Click on the image to see the image legend
Ataxin 1 Antibody is a Mouse Monoclonal against Ataxin 1.
Research Articles on Ataxin 1 (ATXN1)
| Target | Ataxin 1 (ATXN1) |
| Clonality | Monoclonal |
| Reactivity | Human, Mouse, Rat |
| Tested Applications | WB, IHC, IF/ICC, IP |
| Host | Mouse |
| Recommended dilutions | WB: 1/1000, IF/ICC: 1/100. Optimal dilutions/concentrations should be determined by the end user. |
| Conjugation | FITC |
| Excitation/Emission | 499/515 |
| Laser Line | 488 |
| Immunogen | Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). |
| Isotype | IgG2b |
| Purification | Purified by Protein G. |
| Storage | Aliquot and store at -20°C. Avoid repeated freeze/thaw cycles. |
| UniProt Primary AC | P54254 (UniProt, ExPASy) |
| UniProt Secondary AC | Q8C866 |
| UniProt Entry Name | ATX1_MOUSE |
| GeneID | 20238 |
| NCBI Accession | NP_001186233.1 |
| KEGG | mmu:20238 |
| String | 10090.ENSMUSP00000137439 |
| Buffer | PBS, pH 7.4, 50% glycerol, 0.1% sodium azide. |
| Specificity | Detects ~85kDa. |
| Concentration | 1 mg/ml |
| Availability | Shipped within 5-12 working days. |
| Note | This product is for research use only. |