+44 (0) 1223 755950
+1 832 327 7413
Click on the image to see the image legend
Target | Ataxin 1 (ATXN1) |
Clonality | Monoclonal |
Reactivity | Human, Mouse, Rat |
Tested Applications | WB, IHC, IF/ICC, IP |
Host | Mouse |
Recommended dilutions | WB: 1/1000, IF/ICC: 1/100. Optimal dilutions/concentrations should be determined by the end user. |
Conjugation | ATTO488 |
Excitation/Emission | 500/520 |
Laser Line | 488 |
Immunogen | Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). |
Isotype | IgG2b |
Purification | Purified by Protein G. |
Storage | Aliquot and store at -20°C. Avoid repeated freeze/thaw cycles. |
UniProt Primary AC | P54254 (UniProt, ExPASy) |
UniProt Secondary AC | Q8C866 |
UniProt Entry Name | ATX1_MOUSE |
GeneID | 20238 |
NCBI Accession | NP_001186233.1 |
KEGG | mmu:20238 |
String | 10090.ENSMUSP00000137439 |
Buffer | PBS, pH 7.4, 50% glycerol, 0.1% sodium azide. |
Specificity | Detects ~85kDa. |
Concentration | 1 mg/ml |
Availability | Shipped within 5-12 working days. |
Note | This product is for research use only. |