Ataxin 1 (ATXN1) Antibody

REQUEST MORE INFO
Catalogue No: abx445066
Price: US$638.00
(Size: 100 µg)

Click on the image to see the image legend

Available Options

* Size:

Add to Shopping Cart Buy It Now GET A QUOTE

Documents

Datasheet SDS
Ataxin 1 Antibody is a Mouse Monoclonal antibody against Ataxin 1.

Target Ataxin 1 (ATXN1)
Clonality Monoclonal
Reactivity Human, Mouse, Rat
Tested Applications WB, IHC, IF/ICC, IP
Host Mouse
Recommended dilutions WB: 1/1000, IF/ICC: 1/100. Optimal dilutions/concentrations should be determined by the end user.
Conjugation Unconjugated
Immunogen Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
Isotype IgG2b
Purification Purified by Protein G.
Storage Aliquot and store at -20°C. Avoid repeated freeze/thaw cycles.
UniProt Primary AC P54254 (UniProt, ExPASy)
UniProt Secondary AC Q8C866
UniProt Entry Name ATX1_MOUSE
GeneID 20238
NCBI Accession NP_001186233.1
KEGG mmu:20238
String 10090.ENSMUSP00000137439
Buffer PBS, pH 7.4, 50% glycerol, 0.1% sodium azide.
Specificity Detects ~85kDa.
Concentration 1 mg/ml
Availability Shipped within 5-12 working days.
Note This product is for research use only.
Research Articles on Ataxin 1 (ATXN1)


Write a review