BCA-1 / BLC (CXCL13) Protein

REQUEST MORE INFO
Catalogue No: abx260687
Price: US$261.00
(Size: 5 µg)

Click on the image to see the image legend

Available Options

* Size:



Add to Shopping Cart Buy It Now GET A QUOTE

Documents

Datasheet SDS
Human BCA-1/ BLC (CXCL13) Protein is a recombinant chemokine.

Target BCA 1
Origin Human
Expression Recombinant
Tested Applications SDS-PAGE
Host E. coli
Conjugation Unconjugated
Form Lyophilized
Purity > 97% (SDS-PAGE and RP-HPLC)
Reconstitution It is recommended to reconstitute the lyophilized CXCL13 in sterile 18MΩ-cm H2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.
Storage BCA1 should be stored desiccated below -18 °C. Upon reconstitution BCA1 should be stored at 4 °C between 2-7 days and for future use below -18 °C. Avoid repeated freeze/thaw cycles.
UniProt Primary AC O43927 (UniProt, ExPASy)
UniProt Entry Name CXL13_HUMAN
KEGG hsa:10563
String 9606.ENSP00000286758
Sequence VLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNG CPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKR SSSTLPVPVFKRKIP.
Biological Activity Determined by its ability to chemoattract human B cells using a concentration range of 1-1ng/ml corresponding to a Specific Activity of 1,-1,,IU/mg.
Availability Shipped within 5-10 working days.
Note This product is for research use only.

Not for human consumption, cosmetic, therapeutic or diagnostic use.
Research Articles on BCA 1


Write a review

Tags:
(Click to show)