Rat Biliverdin Reductase A (BLVRA) Protein

REQUEST MORE INFO
Catalogue No: abx675046
Price: US$870.00
(Size: 50 µg)

Click on the image to see the image legend

Available Options

* Size:



Add to Shopping Cart Buy It Now GET A QUOTE

Documents

Datasheet SDS
BVR Protein is a protein produced in Rat.

Target Biliverdin Reductase A (BLVRA)
Origin Rat
Expression Native
Tested Applications WB, SDS-PAGE
Host Rat
Purity > 90%
Purification Ion-exchange Purified
Storage Store at -80°C.
UniProt Primary AC P46844 (UniProt, ExPASy)
UniProt Entry Name BIEA_RAT
GeneID 116599
NCBI Accession NP_446302.1
KEGG rno:116599
String 10116.ENSRNOP00000015843
Molecular Weight 36 kDa
Sequence Fragment Full Length
Sequence MDAEPKRKFGVVVVGVGRAGSVRLRDLKDPRSAAFLNLIGFVSRRELGSLDEVRQISLEDALRSQEIDVAYICSESSSHEDYIRQFLQAGKHVLVEYPMTLSFAAAQELWELAAQKGRVLHEEHVELLMEEFEFLRREVLGKELLKGSLRFTASPLEEERFGFPAFSGISRLTWLVSLFGELSLISATLEERKEDQYMKMTVQLETQNKGLLSWIEEKGPGLKRNRYVNFQFTSGSLEEVPSVGVNKNIFLKDQDIFVQKLLDQVSAEDLAAEKKRIMHCLGLASDIQKLCHQKK
Buffer 10 mM Tris pH7.5, 0.1 mM EDTA, 0.2 mM DTT, 20% glycerol.
Availability Shipped within 5-12 working days.
Note This product is for research use only.

Not for human consumption, cosmetic, therapeutic or diagnostic use.
Research Articles on Biliverdin Reductase A (BLVRA)


Write a review

Tags:
(Click to show)