+44 (0) 1223 755950
+1 832 327 7413
Click on the image to see the image legend
Target | Biliverdin Reductase A (BLVRA) |
Origin | Rat |
Expression | Native |
Tested Applications | WB, SDS-PAGE |
Host | Rat |
Purity | > 90% |
Purification | Ion-exchange Purified |
Storage | Store at -80°C. |
UniProt Primary AC | P46844 (UniProt, ExPASy) |
UniProt Entry Name | BIEA_RAT |
GeneID | 116599 |
NCBI Accession | NP_446302.1 |
KEGG | rno:116599 |
String | 10116.ENSRNOP00000015843 |
Molecular Weight | 36 kDa |
Sequence Fragment | Full Length |
Sequence | MDAEPKRKFGVVVVGVGRAGSVRLRDLKDPRSAAFLNLIGFVSRRELGSLDEVRQISLEDALRSQEIDVAYICSESSSHEDYIRQFLQAGKHVLVEYPMTLSFAAAQELWELAAQKGRVLHEEHVELLMEEFEFLRREVLGKELLKGSLRFTASPLEEERFGFPAFSGISRLTWLVSLFGELSLISATLEERKEDQYMKMTVQLETQNKGLLSWIEEKGPGLKRNRYVNFQFTSGSLEEVPSVGVNKNIFLKDQDIFVQKLLDQVSAEDLAAEKKRIMHCLGLASDIQKLCHQKK |
Buffer | 10 mM Tris pH7.5, 0.1 mM EDTA, 0.2 mM DTT, 20% glycerol. |
Availability | Shipped within 5-12 working days. |
Note | This product is for research use only. Not for human consumption, cosmetic, therapeutic or diagnostic use. |