+44 (0) 1223 755950
+1 832 327 7413
Click on the image to see the image legend
Target | CNTF |
Origin | Rat |
Expression | Recombinant |
Tested Applications | SDS-PAGE |
Conjugation | Unconjugated |
Form | Lyophilized |
Purity | > 99% (SDS-PAGE) |
UniProt Primary AC | P20294 (UniProt, ExPASy) |
UniProt Entry Name | CNTF_RAT |
KEGG | rno:25707 |
String | 10116.ENSRNOP00000016690 |
Sequence | AFAEQTPLTL HRRDLSSRSIWLARKIRSDLTALMESYVKHQGLNKNINLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM. |
Availability | Shipped within 5-10 working days. |
Note | This product is for research use only. Not for human consumption, cosmetic, therapeutic or diagnostic use. |