+44 (0) 1223 755950
+1 832 327 7413
Click on the image to see the image legend
Target | 10 KDa Heat Shock Protein, Mitochondrial / HSP10 (HSPE1) |
Origin | Human |
Expression | Recombinant |
Tested Applications | WB, SDS-PAGE |
Host | E. coli |
Purity | > 90% (SDS-PAGE) |
Purification | Purified by multi-step chromatography. |
Storage | Store at -20°C. |
UniProt Primary AC | P61604 (UniProt, ExPASy) |
UniProt Secondary AC | O95421, Q04984, Q53X54, Q9UDH0 |
UniProt Entry Name | CH10_HUMAN |
GeneID | 3336 |
NCBI Accession | NM_002157.2 |
KEGG | hsa:3336 |
String | 9606.ENSP00000233893 |
Molecular Weight | 10 kDa |
Sequence | MAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD |
Buffer | 20 mM Tris, pH 7.5, 0.3 M NaCl, 10% glycerol, 1 mM DTT. |
Concentration | 0.9 mg/ml |
Availability | Shipped within 5-12 working days. |
Note | This product is for research use only. Not for human consumption, cosmetic, therapeutic or diagnostic use. |