Human 10 KDa Heat Shock Protein, Mitochondrial / HSP10 (HSPE1) Protein

REQUEST MORE INFO
Catalogue No: abx675036
Price: US$507.50
(Size: 50 µg)

Click on the image to see the image legend

Available Options

* Size:



Add to Shopping Cart Buy It Now GET A QUOTE

Documents

Datasheet SDS
Cpn10 Protein is a protein produced in Human.

Target 10 KDa Heat Shock Protein, Mitochondrial / HSP10 (HSPE1)
Origin Human
Expression Recombinant
Tested Applications WB, SDS-PAGE
Host E. coli
Purity > 90% (SDS-PAGE)
Purification Purified by multi-step chromatography.
Storage Store at -20°C.
UniProt Primary AC P61604 (UniProt, ExPASy)
UniProt Secondary AC O95421, Q04984, Q53X54, Q9UDH0
UniProt Entry Name CH10_HUMAN
GeneID 3336
NCBI Accession NM_002157.2
KEGG hsa:3336
String 9606.ENSP00000233893
Molecular Weight 10 kDa
Sequence MAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD
Buffer 20 mM Tris, pH 7.5, 0.3 M NaCl, 10% glycerol, 1 mM DTT.
Concentration 0.9 mg/ml
Availability Shipped within 5-12 working days.
Note This product is for research use only.

Not for human consumption, cosmetic, therapeutic or diagnostic use.
Research Articles on 10 KDa Heat Shock Protein, Mitochondrial / HSP10 (HSPE1)


Write a review