+44 (0) 1223 755950
+1 832 327 7413
Click on the image to see the image legend
Target | Cyclin-Dependent Kinase Inhibitor 2A (CDKN2A) |
Origin | Human |
Expression | Recombinant |
Tested Applications | SDS-PAGE |
Host | E. coli |
Recommended dilutions | Optimal dilutions/concentrations should be determined by the end user. |
Form | Lyophilized |
Purity | > 95% (SDS-PAGE and RP-HPLC) |
Storage | Store lyophilized below -18°C. After reconstitution, store at 4 °C for up to 1 week, or below -18°C for long-term storage. For long term storage, it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid repeated freeze/thaw cycles. |
UniProt Primary AC | P42771 (UniProt, ExPASy) |
UniProt Entry Name | CDN2A_HUMAN |
Gene Symbol | CDKN2A |
GeneID | 1029 |
OMIM | 600160 155601 |
HGNC | 1787 |
KEGG | hsa:1029 |
Ensembl | ENSG00000147889 |
String | 9606.ENSP00000418915 |
Sequence | MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD. |
Activity | Not tested |
Availability | Shipped within 5-10 working days. |
Note | This product is for research use only. Not for human consumption, cosmetic, therapeutic or diagnostic use. |