Human Cyclin-Dependent Kinase Inhibitor 2A (CDKN2A) Protein

REQUEST MORE INFO
Catalogue No: abx073527
Price: US$261.00
(Size: 5 µg)

Click on the image to see the image legend

Available Options

* Size:



Add to Shopping Cart Buy It Now GET A QUOTE

Documents

Datasheet SDS
Cyclin-Dependent Kinase Inhibitor 2A Protein is a recombinant protein kinases.

Target Cyclin-Dependent Kinase Inhibitor 2A (CDKN2A)
Origin Human
Expression Recombinant
Tested Applications SDS-PAGE
Host E. coli
Recommended dilutions Optimal dilutions/concentrations should be determined by the end user.
Form Lyophilized
Purity > 95% (SDS-PAGE and RP-HPLC)
Storage Store lyophilized below -18°C. After reconstitution, store at 4 °C for up to 1 week, or below -18°C for long-term storage. For long term storage, it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid repeated freeze/thaw cycles.
UniProt Primary AC P42771 (UniProt, ExPASy)
UniProt Entry Name CDN2A_HUMAN
Gene Symbol CDKN2A
GeneID 1029
OMIM 600160 155601
HGNC 1787
KEGG hsa:1029
Ensembl ENSG00000147889
String 9606.ENSP00000418915
Sequence MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD.
Activity Not tested
Availability Shipped within 5-10 working days.
Note This product is for research use only.

Not for human consumption, cosmetic, therapeutic or diagnostic use.
Research Articles on Cyclin-Dependent Kinase Inhibitor 2A (CDKN2A)


Write a review

Tags:
(Click to show)