+44 (0) 1223 755950
+1 832 327 7413
Gamma-Enolase (ENO2) Antibody
REQUEST MORE INFO
Catalogue No: abx131862
US$290.00
US$203.00
(Size: 100 µl)
Reviews: 
(0 Publications and Reviews)
(0 Publications and Reviews)
Click on the image to see the image legend
ENO2 Antibody is a Mouse Monoclonal against ENO2.
Research Articles on Gamma-Enolase (ENO2)
| Target | Gamma-Enolase (ENO2) |
| Clonality | Monoclonal |
| Reactivity | Human |
| Tested Applications | WB, IHC, IF/ICC |
| Host | Mouse |
| Recommended dilutions | WB: 0.5-5 µg/ml, IHC: 5-30 µg/ml, IF/ICC: 5-30 µg/ml. Optimal dilutions/concentrations should be determined by the end user. |
| Conjugation | Unconjugated |
| Immunogen | Ser2-Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT |
| Isotype | IgG2b Kappa |
| Form | Liquid |
| Purification | Purified by Protein A and Protein G affinity chromatography. |
| Storage | Aliquot and store at -20°C. Avoid repeated freeze/thaw cycles. |
| UniProt Primary AC | P09104 (UniProt, ExPASy) |
| UniProt Secondary AC | B7Z2X9, Q96J33 |
| UniProt Entry Name | ENOG_HUMAN |
| Gene Symbol | ENO2 |
| GeneID | 2026 |
| OMIM | 131360 |
| NCBI Accession | NP_001966.1 NM_001975.2 |
| HGNC | 3353 |
| KEGG | hsa:2026 |
| Ensembl | ENSG00000111674 |
| String | 9606.ENSP00000437402 |
| Buffer | 0.01 M PBS, pH 7.4, containing 0.05% Proclin-300, 50% glycerol. |
| Availability | Shipped within 5-7 working days. |
| Note | This product is for research use only. |