+44 (0) 1223 755950
+1 832 327 7413
Eotaxin-2 (CCL24) Protein
REQUEST MORE INFO
Catalogue No: abx261546
Price:
US$261.00
(Size: 5 µg)
Reviews: 
(0 Publications and Reviews)
(0 Publications and Reviews)
Click on the image to see the image legend
Human Eotaxin-2 (CCL24) Protein is a recombinant chemokine.
Research Articles on Eotaxin 2
| Target | Eotaxin 2 |
| Origin | Human |
| Expression | Recombinant |
| Tested Applications | SDS-PAGE |
| Host | E. coli |
| Conjugation | Unconjugated |
| Form | Lyophilized |
| Purity | > 97% (SDS-PAGE and RP-HPLC) |
| Reconstitution | It is recommended to reconstitute the lyophilized CCL24 Human Recombinant in sterile 18MΩ-cm H2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions. |
| Storage | Eotaxin-2 should be stored desiccated below -18 °C. Upon reconstitution CCL24 should be stored at 4 °C between 2-7 days and for future use below -18 °C. Avoid repeated freeze/thaw cycles. |
| UniProt Primary AC | O00175 (UniProt, ExPASy) |
| UniProt Secondary AC | B2R5K2 |
| UniProt Entry Name | CCL24_HUMAN |
| KEGG | hsa:6369 |
| String | 9606.ENSP00000400533 |
| Sequence | VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKGGVIFTTKKGQQFCGDPKQEWV QRYMKNLDAKQKKASPRARAVA. |
| Biological Activity | The activity is determined by the chemoattract of human PBE (peripheral blood eosinophils) at a concentration between 5-1 ng/ml corresponding to a Specific Activity of 1,-2,IU/mg. |
| Availability | Shipped within 5-10 working days. |
| Note | This product is for research use only. Not for human consumption, cosmetic, therapeutic or diagnostic use. |