+44 (0) 1223 755950
+1 832 327 7413
Click on the image to see the image legend
Target | Follicle Stimulating Hormone (FSH) |
Origin | Human |
Expression | Recombinant |
Tested Applications | SDS-PAGE |
Host | HEK293 cells |
Conjugation | Unconjugated |
Form | Lyophilized |
Purity | > 95% (SDS-PAGE) |
Purification | Purified by proprietary chromatographic techniques. 0.2 µm filtered prior to lyophilization. |
Reconstitution | Reconstitute in sterile 18 MΩ · cm water to a concentration of at least 0.1 mg/ml. This stock solution can be further diluted if required. |
Storage | Stable at room temperature for up to 3 weeks. Store below -18 °C for long-term storage. Upon reconstitution, store at 4 °C for up to 7 days and store below -18 °C for long-term storage. For long-term storage, it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid repeated freeze/thaw cycles. |
UniProt Primary AC | P01225 (UniProt, ExPASy) |
UniProt Secondary AC | A2TF08, A5JVV3, Q14D61 |
UniProt Entry Name | FSHB_HUMAN |
KEGG | hsa:2488 |
String | 9606.ENSP00000416606 |
Molecular Weight | 38 kDa |
Sequence Fragment | Ala25-Ser116 (alpha chain) and Asn19-Glu129 (beta chain) |
Sequence |
FSH subunit alpha: APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS. FSH subunit beta: NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE. |
Buffer | Prior to lyophilization: PBS, pH 7.4. |
Biological Activity | The ED50 as determined by cAMP accumulation in human FSH Receptor-transfected CHO cells was found to be 80-450 pg/ml. |
Availability | Shipped within 5-10 working days. |
Note | This product is for research use only. Not for human consumption, cosmetic, therapeutic or diagnostic use. |