Human Follicle Stimulating Hormone (FSH) Protein

REQUEST MORE INFO
Catalogue No: abx262431
Price: US$261.00
(Size: 2 µg)

Click on the image to see the image legend

Available Options

* Size:



Add to Shopping Cart Buy It Now GET A QUOTE

Documents

Datasheet SDS
Human Follicle Stimulating Hormone is a recombinant protein expressed in HEK293 cells. It is a is heterodimeric, glycosylated protein consisting of partial length human FSH alpha and human FSH beta chains.

Target Follicle Stimulating Hormone (FSH)
Origin Human
Expression Recombinant
Tested Applications SDS-PAGE
Host HEK293 cells
Conjugation Unconjugated
Form Lyophilized
Purity > 95% (SDS-PAGE)
Purification Purified by proprietary chromatographic techniques. 0.2 µm filtered prior to lyophilization.
Reconstitution Reconstitute in sterile 18 MΩ · cm water to a concentration of at least 0.1 mg/ml. This stock solution can be further diluted if required.
Storage Stable at room temperature for up to 3 weeks. Store below -18 °C for long-term storage. Upon reconstitution, store at 4 °C for up to 7 days and store below -18 °C for long-term storage. For long-term storage, it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid repeated freeze/thaw cycles.
UniProt Primary AC P01225 (UniProt, ExPASy)
UniProt Secondary AC A2TF08, A5JVV3, Q14D61
UniProt Entry Name FSHB_HUMAN
KEGG hsa:2488
String 9606.ENSP00000416606
Molecular Weight 38 kDa
Sequence Fragment Ala25-Ser116 (alpha chain) and Asn19-Glu129 (beta chain)
Sequence FSH subunit alpha: APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS.
FSH subunit beta: NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE.
Buffer Prior to lyophilization: PBS, pH 7.4.
Biological Activity The ED50 as determined by cAMP accumulation in human FSH Receptor-transfected CHO cells was found to be 80-450 pg/ml.
Availability Shipped within 5-10 working days.
Note This product is for research use only.

Not for human consumption, cosmetic, therapeutic or diagnostic use.
Research Articles on Follicle Stimulating Hormone (FSH)


Write a review