+44 (0) 1223 755950
+1 832 327 7413
Click on the image to see the image legend
Target | Somatotropin Receptor (GHR) |
Origin | Rabbit |
Expression | Recombinant |
Tested Applications | SDS-PAGE |
Host | E. coli |
Conjugation | Unconjugated |
Form | Lyophilized |
Purity | > 98% (SDS-PAGE) |
UniProt Primary AC | P19941 (UniProt, ExPASy) |
UniProt Entry Name | GHR_RABIT |
KEGG | ocu:100009325 |
String | 9986.ENSOCUP00000007343 |
Sequence | AFSGSEATPATLGRASESVQRVHPGLGTNSSGKPKFTKCRSPELETFSCHWTDGVHHGLKSPGSVQLFYIRRNTQEWTQEWKECPDYVSAGENSCYFNSSYTSIWIPYCIKLTNNGGMVDQKCFSVEEIVQPDPPIGLNWTLLNVSLTGIHADIQVRWEPPPNADVQKGWIVLEYELQYKEVNETQWKMMDPVLSTSVPVYSLRLDKEYEVRVRSRQRSSEKYGEFSEVLYVTLPQMSPFTCEEDFRFP. |
Availability | Shipped within 5-10 working days. |
Note | This product is for research use only. Not for human consumption, cosmetic, therapeutic or diagnostic use. |