+44 (0) 1223 755950
+1 832 327 7413
HCC-1 (CCL14) Protein
REQUEST MORE INFO
Catalogue No: abx260679
Price:
US$261.00
(Size: 2 µg)
Reviews: 
(0 Publications and Reviews)
(0 Publications and Reviews)
Click on the image to see the image legend
Human HCC-1 (CCL14) Protein is a recombinant chemokine.
Research Articles on HCC 1
| Target | HCC 1 |
| Origin | Human |
| Expression | Recombinant |
| Tested Applications | SDS-PAGE |
| Host | E. coli |
| Conjugation | Unconjugated |
| Form | Lyophilized |
| Purity | > 97% (SDS-PAGE and RP-HPLC) |
| Reconstitution | It is recommended to reconstitute the lyophilized HCC-1 in sterile 18MΩ-cm H2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions. |
| Storage | HCC1 should be stored desiccated below -18 °C. Upon reconstitution CCL14 should be stored at 4 °C between 2-7 days and for future use below -18 °C. Avoid repeated freeze/thaw cycles. |
| UniProt Primary AC | Q16627 (UniProt, ExPASy) |
| UniProt Secondary AC | E1P649, E1P650, Q13954 |
| UniProt Entry Name | CCL14_HUMAN |
| KEGG | hsa:6358 |
| Sequence | TESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN. |
| Biological Activity | The Biological activity is calculated by its ability to chemoattract Human monocytes at 5-2ng/ml corresponding to a Specific Activity of 5,-2,IU/mg. |
| Availability | Shipped within 5-10 working days. |
| Note | This product is for research use only. Not for human consumption, cosmetic, therapeutic or diagnostic use. |