+44 (0) 1223 755950
+1 832 327 7413
Click on the image to see the image legend
Target | Omp Pylori |
Expression | Recombinant |
Conjugation | Unconjugated |
Form | Liquid |
Purity | > 95% (12% PAGE with Coomassie staining) |
Sequence | MLVTKLAPDFKAPAVLGNNEVDEHFELSKNLGKNGAILFFWPKDFTFVCPTEIIAFDKRVKDFQEKGFNVIGVSIDSEQVHFAWKNTPVEKGGIGQVTFPMVADITKSISRDYDVLFEEAIALRGAFLIDKNMKVRHAVINDLPLGRNADEMLRMVDALLHFEEHGEVCPAGWRKGDKGMKATHQGVAEYLKENSIKL. |
Activity | Not tested |
Availability | Shipped within 5-10 working days. |
Note | This product is for research use only. Not for human consumption, cosmetic, therapeutic or diagnostic use. |