+44 (0) 1223 755950
+1 832 327 7413
Click on the image to see the image legend
Target | HSP90 |
Origin | Protozoan |
Expression | Recombinant |
Tested Applications | WB, SDS-PAGE |
Host | E. coli |
Purity | > 90% |
Purification | Purified by affinity chromatography. |
Storage | Store at -20°C. |
UniProt Primary AC | Q8IL32 (UniProt, ExPASy) |
GeneID | 811999 |
NCBI Accession | XP_001348591.1 |
Molecular Weight | 21.4 kDa |
Sequence Fragment | Partial |
Sequence | QPVLEINPNHFIIKQLNHLIQIDKMNLQNSEIAEQIFDVASMQGGYTIDDTGLFAKRVIGMMEKNAEQYLMNVQSNISNNTLNNNTSGSEMPQNNSPNELQSEMKSTNGIDDNSNISENKINESSSNQNNIGENSIAEENNIKNIAESDVNKINLGENDVSQNTMHKQDSGLFNLDPSILNSNMLSGSDKTLL |
Buffer | 50 mM Tris/HCl pH7.5, 300 mM NaCl, 10% glycerol. |
Availability | Shipped within 5-12 working days. |
Note | This product is for research use only. Not for human consumption, cosmetic, therapeutic or diagnostic use. |