Human Enolase, Neuron Specific (NSE) Protein

REQUEST MORE INFO
Catalogue No: abx066426
Price: US$232.00
(Size: 10 µg)

Click on the image to see the image legend

Available Options

* Size:







Add to Shopping Cart Buy It Now GET A QUOTE

Documents

Datasheet SDS
Recombinant ENO2 is a recombinant Human protein produced in a Prokaryotic expression system (E. coli).

Target Enolase, Neuron Specific (NSE)
Origin Human
Expression Recombinant
Tested Applications WB, SDS-PAGE
Host E. coli
Conjugation Unconjugated
Form Lyophilized
Purity > 97%
Reconstitution To keep the original salt concentration, we recommend reconstituting to the original concentration prior to lyophilization (see Concentration) in ddH2O. If a lower concentration is required, dilute in PBS, pH 7.4. If a higher concentration is required, the product can be reconstituted directly in PBS, pH 7.4, though please note that this will change the overall salt concentration. The stock concentration should be between 0.1-1.0 mg/ml. Do not vortex.
Storage Store at 2-8 °C for up to one month. Store at -80 °C for up to one year. Avoid repeated freeze/thaw cycles.
UniProt Primary AC P09104 (UniProt, ExPASy)
UniProt Secondary AC B7Z2X9, Q96J33
UniProt Entry Name ENOG_HUMAN
KEGG hsa:2026
String 9606.ENSP00000437402
Molecular Weight Calculated MW: 37.1 kDa
Sequence Fragment Ser2-Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT
Tag N-terminal His tag
Buffer Prior to lyophilization: PBS, pH 7.4, containing 0.01% Sarcosyl, 1 mM DTT, 5% Trehalose and Proclin-300.
Activity Not tested
Concentration Prior to lyophilization: 200 µg/ml
Availability Shipped within 5-12 working days.
Note This product is for research use only.

Not for human consumption, cosmetic, therapeutic or diagnostic use.
Research Articles on Enolase, Neuron Specific (NSE)


Write a review

Tags:
(Click to show)