+44 (0) 1223 755950
+1 832 327 7413
Click on the image to see the image legend
Target | I TAC |
Origin | Human |
Expression | Recombinant |
Tested Applications | SDS-PAGE |
Host | E. coli |
Conjugation | Unconjugated |
Form | Lyophilized |
Purity | > 97% (SDS-PAGE and RP-HPLC) |
Reconstitution | It is recommended to reconstitute the lyophilized I-TAC in sterile 18MΩ-cm H2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions. |
Storage | I-TAC should be stored desiccated below -18 °C. Upon reconstitution I-TAC should be stored at 4 °C between 2-7 days and for future use below -18 °C. Avoid repeated freeze/thaw cycles. |
UniProt Primary AC | O14625 (UniProt, ExPASy) |
UniProt Secondary AC | Q53YA3, Q92840 |
UniProt Entry Name | CXL11_HUMAN |
KEGG | hsa:6373 |
String | 9606.ENSP00000306884 |
Sequence | FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF. |
Biological Activity | Determined by its ability to chemoattract human IL-2 activated T-Lymphocytes using a concentration range of.1-1. ng/ml. |
Availability | Shipped within 5-10 working days. |
Note | This product is for research use only. Not for human consumption, cosmetic, therapeutic or diagnostic use. |