+44 (0) 1223 755950
+1 832 327 7413
I-TAC (CXCL11) Protein
REQUEST MORE INFO
Catalogue No: abx261587
Price:
US$261.00
(Size: 5 µg)
Reviews: 
(0 Publications and Reviews)
(0 Publications and Reviews)
Click on the image to see the image legend
Human I-TAC (CXCL11) Protein is a recombinant chemokine.
Research Articles on I TAC
| Target | I TAC |
| Origin | Human |
| Expression | Recombinant |
| Tested Applications | SDS-PAGE |
| Host | E. coli |
| Conjugation | Unconjugated |
| Form | Lyophilized |
| Purity | > 97% (SDS-PAGE and RP-HPLC) |
| Reconstitution | It is recommended to reconstitute the lyophilized I-TAC in sterile 18MΩ-cm H2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions. |
| Storage | I-TAC should be stored desiccated below -18 °C. Upon reconstitution I-TAC should be stored at 4 °C between 2-7 days and for future use below -18 °C. Avoid repeated freeze/thaw cycles. |
| UniProt Primary AC | O14625 (UniProt, ExPASy) |
| UniProt Secondary AC | Q53YA3, Q92840 |
| UniProt Entry Name | CXL11_HUMAN |
| KEGG | hsa:6373 |
| String | 9606.ENSP00000306884 |
| Sequence | FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF. |
| Biological Activity | Determined by its ability to chemoattract human IL-2 activated T-Lymphocytes using a concentration range of.1-1. ng/ml. |
| Availability | Shipped within 5-10 working days. |
| Note | This product is for research use only. Not for human consumption, cosmetic, therapeutic or diagnostic use. |