+44 (0) 1223 755950
+1 832 327 7413
Click on the image to see the image legend
Target | Amine Oxidase Copper Containing 1 (AOC1) |
Origin | Pig |
Expression | Recombinant |
Tested Applications | WB, SDS-PAGE |
Host | E. coli |
Conjugation | Unconjugated |
Form | Lyophilized |
Purity | > 95% |
Reconstitution | To keep the original salt concentration, we recommend reconstituting to the original concentration prior to lyophilization (see Concentration) in ddH2O. If a lower concentration is required, dilute in PBS, pH 7.4. If a higher concentration is required, the product can be reconstituted directly in PBS, pH 7.4, though please note that this will change the overall salt concentration. The stock concentration should be between 0.1-1.0 mg/ml. Do not vortex. |
Storage | Store at 2-8 °C for up to one month. Store at -80 °C for up to one year. Avoid repeated freeze/thaw cycles. |
UniProt Primary AC | Q9TRC7 (UniProt, ExPASy) |
UniProt Secondary AC | F1SSL3, Q29317 |
UniProt Entry Name | AOC1_PIG |
NCBI Accession | XM_003134553.1 |
String | 9823.ENSSSCP00000017422 |
Molecular Weight | Calculated MW: 11.3 kDa |
Sequence Fragment | Ser27-Gln113 |
Sequence | SPRTPGGKAGVFADLSAQELKAVHSFLWSQKELKLEPSGTLTMAKNSVFLIEMLLPKKQHVLKFLDKGHRRPVREARAVIFFGAQEQ |
Tag | N-terminal His tag |
Buffer | Prior to lyophilization: PBS, pH 7.4, containing 0.01% Sarcosyl, 1 mM DTT, 5% Trehalose and Proclin-300. |
Activity | Not tested |
Concentration | Prior to lyophilization: 200 µg/ml |
Availability | Shipped within 5-12 working days. |
Note | This product is for research use only. Not for human consumption, cosmetic, therapeutic or diagnostic use. |