+44 (0) 1223 755950
+1 832 327 7413
Click on the image to see the image legend
Target | IL1B |
Origin | Human |
Expression | Recombinant |
Tested Applications | SDS-PAGE |
Conjugation | Unconjugated |
Form | Liquid |
Purity | > 95% (SDS-PAGE and RP-HPLC) |
UniProt Primary AC | P01584 (UniProt, ExPASy) |
UniProt Secondary AC | Q53X59, Q53XX2, Q7M4S7, Q7RU01, Q96HE5, Q9UCT6 |
UniProt Entry Name | IL1B_HUMAN |
KEGG | hsa:3553 |
String | 9606.ENSP00000263341 |
Sequence | APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS |
Activity | Not tested |
Availability | Shipped within 5-10 working days. |
Note | This product is for research use only. Not for human consumption, cosmetic, therapeutic or diagnostic use. |