+44 (0) 1223 755950
+1 832 327 7413
Search
Contact us to order SIGN UP NOW!
Sign up to our newsletter
Rat Interleukin 1 Beta (IL1B) Protein
REQUEST MORE INFO
Catalogue No: abx262247
Price:
US$261.00
(Size: 2 µg)
Reviews: 
(0 Publications and Reviews)
(0 Publications and Reviews)
Click on the image to see the image legend
Interleukin-1 beta Protein is a recombinant cytokine.
Research Articles on IL1B
| Target | IL1B |
| Origin | Rat |
| Expression | Recombinant |
| Tested Applications | SDS-PAGE |
| Conjugation | Unconjugated |
| Form | Lyophilized |
| Purity | > 97% (SDS-PAGE) |
| UniProt Primary AC | Q63264 (UniProt, ExPASy) |
| Sequence | MVPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSFVQGETSNDKIPVALGLKGLNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKTKVEFESAQFPNWYISTSQAEHRPVFLGNSNGRDIVDFTMEPVSS. |
| Availability | Shipped within 5-10 working days. |
| Note | This product is for research use only. Not for human consumption, cosmetic, therapeutic or diagnostic use. |
Tags:
(Click to show)
Interleukin 1β,
IL-1β,
Interleukin 1 beta,
IL-1 beta,
IL 1B,
IL 1 B,
Interleukin 1b,
Interleukin 1 b,
Interleukin 1,
Beta,
IL-1 Beta,
Catabolin,
IL1F2,
Pro-Interleukin-1-Beta,
Preinterleukin 1 Beta,
Interleukin-1 Beta,
IL1-BETA,
IL-1,
IL1B,
IL-1β,
Interleukin 1 beta,
IL-1 beta,
IL 1 BETA,
IL 1 B,
IL-1 Beta,
Catabolin,
IL1F2,
Pro-Interleukin-1-Beta,
Preinterleukin 1 Beta,
IL1-BETA,
IL-1,
Interleukin 1β Protein,
IL-1β Protein,
Interleukin 1 beta Protein,
IL-1 beta Protein,
IL 1B Protein,
IL 1 B Protein,
Interleukin 1b Protein,
Interleukin 1 b Protein,
Interleukin 1,
Beta Protein,
IL-1 Beta Protein,
Catabolin Protein,
IL1F2 Protein,
Pro-Interleukin-1-Beta Protein,
Preinterleukin 1 Beta Protein,
Interleukin-1 Beta Protein,
IL1-BETA Protein,
IL-1 Protein,
IL1B Protein,
IL-1β Protein,
Interleukin 1 beta Protein,
IL-1 beta Protein,
IL 1 BETA Protein,
IL 1 B Protein,
IL-1 Beta Protein,
Catabolin Protein,
IL1F2 Protein,
Pro-Interleukin-1-Beta Protein,
Preinterleukin 1 Beta Protein,
IL1-BETA,
IL-1 Protein,
Protein Interleukin 1β,
Rat Interleukin 1β,
Rat protein Interleukin 1β,
Interleukin 1β protein,
Rat Interleukin 1β Protein,
Protein IL-1β,
Rat IL-1β,
Rat protein IL-1β,
IL-1β protein,
Rat IL-1β Protein,
Protein Interleukin 1 beta,
Rat Interleukin 1 beta,
Rat protein Interleukin 1 beta,
Interleukin 1 beta protein,
Rat Interleukin 1 beta Protein,
Protein IL-1 beta,
Rat IL-1 beta,
Rat protein IL-1 beta,
IL-1 beta protein,
Rat IL-1 beta Protein,
Protein IL 1B,
Rat IL 1B,
Rat protein IL 1B,
IL 1B protein,
Rat IL 1B Protein,
Protein IL 1 B,
Rat IL 1 B,
Rat protein IL 1 B,
IL 1 B protein,
Rat IL 1 B Protein,
Protein Interleukin 1b,
Rat Interleukin 1b,
Rat protein Interleukin 1b,
Interleukin 1b protein,
Rat Interleukin 1b Protein,
Protein Interleukin 1 b,
Rat Interleukin 1 b,
Rat protein Interleukin 1 b,
Interleukin 1 b protein,
Rat Interleukin 1 b Protein,
Protein Interleukin 1,
Rat Interleukin 1,
Rat protein Interleukin 1,
Interleukin 1 protein,
Rat Interleukin 1 Protein,
Protein Beta,
Rat Beta,
Rat protein Beta,
Beta protein,
Rat Beta Protein,
Protein IL-1 Beta,
Rat IL-1 Beta,
Rat protein IL-1 Beta,
IL-1 Beta protein,
Rat IL-1 Beta Protein,
Protein Catabolin,
Rat Catabolin,
Rat protein Catabolin,
Catabolin protein,
Rat Catabolin Protein,
Protein IL1F2,
Rat IL1F2,
Rat protein IL1F2,
IL1F2 protein,
Rat IL1F2 Protein,
Protein Pro-Interleukin-1-Beta,
Rat Pro-Interleukin-1-Beta,
Rat protein Pro-Interleukin-1-Beta,
Pro-Interleukin-1-Beta protein,
Rat Pro-Interleukin-1-Beta Protein,
Protein Preinterleukin 1 Beta,
Rat Preinterleukin 1 Beta,
Rat protein Preinterleukin 1 Beta,
Preinterleukin 1 Beta protein,
Rat Preinterleukin 1 Beta Protein,
Protein Interleukin-1 Beta,
Rat Interleukin-1 Beta,
Rat protein Interleukin-1 Beta,
Interleukin-1 Beta protein,
Rat Interleukin-1 Beta Protein,
Protein IL1-BETA,
Rat IL1-BETA,
Rat protein IL1-BETA,
IL1-BETA protein,
Rat IL1-BETA Protein,
Protein IL-1,
Rat IL-1,
Rat protein IL-1,
IL-1 protein,
Rat IL-1 Protein,
Protein IL1B,
Rat IL1B,
Rat protein IL1B,
IL1B protein,
Rat IL1B Protein,
Protein IL-1β,
Rat IL-1β,
Rat protein IL-1β,
IL-1β protein,
Rat IL-1β Protein,
Protein Interleukin 1 beta,
Rat Interleukin 1 beta,
Rat protein Interleukin 1 beta,
Interleukin 1 beta protein,
Rat Interleukin 1 beta Protein,
Protein IL-1 beta,
Rat IL-1 beta,
Rat protein IL-1 beta,
IL-1 beta protein,
Rat IL-1 beta Protein,
Protein IL 1 BETA,
Rat IL 1 BETA,
Rat protein IL 1 BETA,
IL 1 BETA protein,
Rat IL 1 BETA Protein,
Protein IL 1 B,
Rat IL 1 B,
Rat protein IL 1 B,
IL 1 B protein,
Rat IL 1 B Protein,
Protein IL-1 Beta,
Rat IL-1 Beta,
Rat protein IL-1 Beta,
IL-1 Beta protein,
Rat IL-1 Beta Protein,
Protein Catabolin,
Rat Catabolin,
Rat protein Catabolin,
Catabolin protein,
Rat Catabolin Protein,
Protein IL1F2,
Rat IL1F2,
Rat protein IL1F2,
IL1F2 protein,
Rat IL1F2 Protein,
Protein Pro-Interleukin-1-Beta,
Rat Pro-Interleukin-1-Beta,
Rat protein Pro-Interleukin-1-Beta,
Pro-Interleukin-1-Beta protein,
Rat Pro-Interleukin-1-Beta Protein,
Protein Preinterleukin 1 Beta,
Rat Preinterleukin 1 Beta,
Rat protein Preinterleukin 1 Beta,
Preinterleukin 1 Beta protein,
Rat Preinterleukin 1 Beta Protein,
Protein IL1-BETA,
Rat IL1-BETA,
Rat protein IL1-BETA,
IL1-BETA protein,
Rat IL1-BETA Protein,
Protein IL-1,
Rat IL-1,
Rat protein IL-1,
IL-1 protein,
Rat IL-1 Protein,
Protein Interleukin 1β Protein,
Rat Interleukin 1β Protein,
Rat protein Interleukin 1β Protein,
Interleukin 1β Protein protein,
Rat Interleukin 1β Protein,
Protein IL-1β Protein,
Rat IL-1β Protein,
Rat protein IL-1β Protein,
IL-1β Protein protein,
Rat IL-1β Protein,
Protein Interleukin 1 beta Protein,
Rat Interleukin 1 beta Protein,
Rat protein Interleukin 1 beta Protein,
Interleukin 1 beta Protein protein,
Rat Interleukin 1 beta Protein,
Protein IL-1 beta Protein,
Rat IL-1 beta Protein,
Rat protein IL-1 beta Protein,
IL-1 beta Protein protein,
Rat IL-1 beta Protein,
Protein IL 1B Protein,
Rat IL 1B Protein,
Rat protein IL 1B Protein,
IL 1B Protein protein,
Rat IL 1B Protein,
Protein IL 1 B Protein,
Rat IL 1 B Protein,
Rat protein IL 1 B Protein,
IL 1 B Protein protein,
Rat IL 1 B Protein,
Protein Interleukin 1b Protein,
Rat Interleukin 1b Protein,
Rat protein Interleukin 1b Protein,
Interleukin 1b Protein protein,
Rat Interleukin 1b Protein,
Protein Interleukin 1 b Protein,
Rat Interleukin 1 b Protein,
Rat protein Interleukin 1 b Protein,
Interleukin 1 b Protein protein,
Rat Interleukin 1 b Protein,
Protein Interleukin 1,
Rat Interleukin 1,
Rat protein Interleukin 1,
Interleukin 1 protein,
Rat Interleukin 1 Protein,
Protein Beta Protein,
Rat Beta Protein,
Rat protein Beta Protein,
Beta Protein protein,
Rat Beta Protein,
Protein IL-1 Beta Protein,
Rat IL-1 Beta Protein,
Rat protein IL-1 Beta Protein,
IL-1 Beta Protein protein,
Rat IL-1 Beta Protein,
Protein Catabolin Protein,
Rat Catabolin Protein,
Rat protein Catabolin Protein,
Catabolin Protein protein,
Rat Catabolin Protein,
Protein IL1F2 Protein,
Rat IL1F2 Protein,
Rat protein IL1F2 Protein,
IL1F2 Protein protein,
Rat IL1F2 Protein,
Protein Pro-Interleukin-1-Beta Protein,
Rat Pro-Interleukin-1-Beta Protein,
Rat protein Pro-Interleukin-1-Beta Protein,
Pro-Interleukin-1-Beta Protein protein,
Rat Pro-Interleukin-1-Beta Protein,
Protein Preinterleukin 1 Beta Protein,
Rat Preinterleukin 1 Beta Protein,
Rat protein Preinterleukin 1 Beta Protein,
Preinterleukin 1 Beta Protein protein,
Rat Preinterleukin 1 Beta Protein,
Protein Interleukin-1 Beta Protein,
Rat Interleukin-1 Beta Protein,
Rat protein Interleukin-1 Beta Protein,
Interleukin-1 Beta Protein protein,
Rat Interleukin-1 Beta Protein,
Protein IL1-BETA Protein,
Rat IL1-BETA Protein,
Rat protein IL1-BETA Protein,
IL1-BETA Protein protein,
Rat IL1-BETA Protein,
Protein IL-1 Protein,
Rat IL-1 Protein,
Rat protein IL-1 Protein,
IL-1 Protein protein,
Rat IL-1 Protein,
Protein IL1B Protein,
Rat IL1B Protein,
Rat protein IL1B Protein,
IL1B Protein protein,
Rat IL1B Protein,
Protein IL-1β Protein,
Rat IL-1β Protein,
Rat protein IL-1β Protein,
IL-1β Protein protein,
Rat IL-1β Protein,
Protein Interleukin 1 beta Protein,
Rat Interleukin 1 beta Protein,
Rat protein Interleukin 1 beta Protein,
Interleukin 1 beta Protein protein,
Rat Interleukin 1 beta Protein,
Protein IL-1 beta Protein,
Rat IL-1 beta Protein,
Rat protein IL-1 beta Protein,
IL-1 beta Protein protein,
Rat IL-1 beta Protein,
Protein IL 1 BETA Protein,
Rat IL 1 BETA Protein,
Rat protein IL 1 BETA Protein,
IL 1 BETA Protein protein,
Rat IL 1 BETA Protein,
Protein IL 1 B Protein,
Rat IL 1 B Protein,
Rat protein IL 1 B Protein,
IL 1 B Protein protein,
Rat IL 1 B Protein,
Protein IL-1 Beta Protein,
Rat IL-1 Beta Protein,
Rat protein IL-1 Beta Protein,
IL-1 Beta Protein protein,
Rat IL-1 Beta Protein,
Protein Catabolin Protein,
Rat Catabolin Protein,
Rat protein Catabolin Protein,
Catabolin Protein protein,
Rat Catabolin Protein,
Protein IL1F2 Protein,
Rat IL1F2 Protein,
Rat protein IL1F2 Protein,
IL1F2 Protein protein,
Rat IL1F2 Protein,
Protein Pro-Interleukin-1-Beta Protein,
Rat Pro-Interleukin-1-Beta Protein,
Rat protein Pro-Interleukin-1-Beta Protein,
Pro-Interleukin-1-Beta Protein protein,
Rat Pro-Interleukin-1-Beta Protein,
Protein Preinterleukin 1 Beta Protein,
Rat Preinterleukin 1 Beta Protein,
Rat protein Preinterleukin 1 Beta Protein,
Preinterleukin 1 Beta Protein protein,
Rat Preinterleukin 1 Beta Protein,
Protein IL1-BETA,
Rat IL1-BETA,
Rat protein IL1-BETA,
IL1-BETA protein,
Rat IL1-BETA Protein,
Protein IL-1 Protein,
Rat IL-1 Protein,
Rat protein IL-1 Protein,
IL-1 Protein protein,
Rat IL-1 Protein