+44 (0) 1223 755950
+1 832 327 7413
Click on the image to see the image legend
Target | Interleukin 10 (IL10) |
Origin | Mouse |
Expression | Recombinant |
Tested Applications | WB, SDS-PAGE |
Host | 293F cell |
Conjugation | Unconjugated |
Form | Lyophilized |
Purity | > 97% |
Reconstitution | To keep the original salt concentration, we recommend reconstituting to the original concentration prior to lyophilization (see Concentration) in ddH2O. If a lower concentration is required, dilute in PBS, pH 7.4. If a higher concentration is required, the product can be reconstituted directly in PBS, pH 7.4, though please note that this will change the overall salt concentration. The stock concentration should be between 0.1-1.0 mg/ml. Do not vortex. |
Storage | Store at 2-8 °C for up to one month. Store at -80 °C for up to one year. Avoid repeated freeze/thaw cycles. |
UniProt Primary AC | P18893 (UniProt, ExPASy) |
UniProt Secondary AC | Q0VBJ1 |
UniProt Entry Name | IL10_MOUSE |
KEGG | mmu:16153 |
String | 10090.ENSMUSP00000016673 |
Molecular Weight | Calculated MW: 20.4 kDa Observed MW: 22 kDa |
Sequence Fragment | Ser19-Ser178 |
Sequence | SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS |
Tag | N-terminal His tag |
Buffer | Prior to lyophilization: 10 mM PBS, pH 7.4, containing 5% trehalose, 0.01% sarcosyl. |
Activity | Not tested |
Concentration | Prior to lyophilization: 200 µg/ml |
Availability | Shipped within 5-7 working days. |
Note | This product is for research use only. Not for human consumption, cosmetic, therapeutic or diagnostic use. |