+44 (0) 1223 755950
+1 832 327 7413
Click on the image to see the image legend
Target | mIL 17 A/F |
Origin | Mouse |
Expression | Recombinant |
Tested Applications | SDS-PAGE |
Conjugation | Unconjugated |
Form | Lyophilized |
Purity | > 97% (SDS-PAGE) |
Sequence | RKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSPWDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRREPQGCSNSFRLEKMLLKVGCTCVKPIVHQAAAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA. |
Activity | Not tested |
Availability | Shipped within 5-10 working days. |
Note | This product is for research use only. Not for human consumption, cosmetic, therapeutic or diagnostic use. |