+44 (0) 1223 755950
+1 832 327 7413
Click on the image to see the image legend
Target | Interleukin 37 (IL37) |
Origin | Human |
Expression | Recombinant |
Tested Applications | SDS-PAGE |
Conjugation | Unconjugated |
Form | Lyophilized |
Purity | > 95% (SDS-PAGE and RP-HPLC) |
UniProt Primary AC | Q9NZH6 (UniProt, ExPASy) |
UniProt Secondary AC | B5BU97, Q56AP9, Q8TD04, Q8TD05, Q9HBF2, Q9HBF3, Q9UHA6 |
UniProt Entry Name | IL37_HUMAN |
String | 9606.ENSP00000263326 |
Sequence | MKNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCLYCDKDKGQSHPSLQLKKEKLMKLAAQKESARRPFIFYRAQVGSWNMLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSEVSD. |
Availability | Shipped within 5-10 working days. |
Note | This product is for research use only. Not for human consumption, cosmetic, therapeutic or diagnostic use. |