+44 (0) 1223 755950
+1 832 327 7413
Click on the image to see the image legend
Target | Interleukin 7 Receptor (IL7R) |
Clonality | Polyclonal |
Reactivity | Human, Mouse |
Tested Applications | ELISA, WB |
Host | Rabbit |
Recommended dilutions | Optimal dilutions/concentrations should be determined by the end user. |
Conjugation | Unconjugated |
Immunogen | Human IL7R. |
Isotype | IgG |
Form | Liquid |
Purification | Antigen Affinity Chromatography. |
Storage | Aliquot and store at -20°C. Avoid repeated freeze/thaw cycles. |
UniProt Primary AC | P16871 (UniProt, ExPASy) |
UniProt Entry Name | IL7RA_HUMAN |
Gene Symbol | IL7R |
GeneID | 3575 |
OMIM | 146661 |
NCBI Accession | NP_002176.2 |
KEGG | hsa:3575 |
String | 9606.ENSP00000306157 |
Sequence | KRIKPIVWPSLPDHKKTLEHLCKKPRKNLNVSFNPESFLDCQIHRVDDIQARDEVEGFLQDTFPQQLEESEKQRLGGDVQSPNCPSEDVVITPESFGRDSSLTCLAGNVSACDAPILSPSRSLDCRESGKNGPHVYQDLLLSLGTTNSTLPPPFSLQSGILTLNPVAQGQPILTSLGSNQEEAYVTMSSFYQNQ |
Buffer | PBS, pH 7.3, containing 0.1% Sodium Azide and 50% Glycerol. |
Availability | Shipped within 5-10 working days. |
Note | This product is for research use only. |