Large-CRP OmcB Protein

REQUEST MORE INFO
Catalogue No: abx600002
Price: US$1,508.00
(Size: 50 µg)

Click on the image to see the image legend

Available Options

* Size:




Add to Shopping Cart Buy It Now GET A QUOTE

Documents

Datasheet SDS
Large-CRP OmcB Protein is a recombinant protein from Chlamydia pneumoniae produced in Baculovirus.

Target Large-CRP OmcB
Origin Bacteria
Expression Recombinant
Tested Applications SDS-PAGE
Host Virus
Purity > 90% (SDS-PAGE)
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Validity 6 months in liquid form, or 12 months in lyophilized form.
Molecular Weight 19.01 kDa
Sequence SAETKPAPVPMTAKKVRLVRRNKQPVEQKSRGAFCDKEFYPCEEGRCQPVEAQQESCYGRLYSVKVNDDCNVEICQSVPEYATVGSPYPIEILAIGKKDCVDVVITQQLPCEAEFVSSDPETTPTSDGKLVWKIDRLGAGDKCKITVWVKPLKEGC
Tag N-terminal His tag
Buffer Tris-based buffer, 50% glycerol.
Availability Shipped within 2-3 months.
Note This product is for research use only.

Not for human consumption, cosmetic, therapeutic or diagnostic use.
Research Articles on Large-CRP OmcB


Write a review