+44 (0) 1223 755950
+1 832 327 7413
Click on the image to see the image legend
Target | Large-CRP OmcB |
Origin | Bacteria |
Expression | Recombinant |
Tested Applications | SDS-PAGE |
Host | Mammalian cells |
Purity | > 90% (SDS-PAGE) |
Storage | Store at -20°C, for extended storage, conserve at -20°C or -80°C. |
Validity | 6 months in liquid form, or 12 months in lyophilized form. |
Molecular Weight | 21.21 kDa |
Sequence | SAETKPAPVPMTAKKVRLVRRNKQPVEQKSRGAFCDKEFYPCEEGRCQPVEAQQESCYGRLYSVKVNDDCNVEICQSVPEYATVGSPYPIEILAIGKKDCVDVVITQQLPCEAEFVSSDPETTPTSDGKLVWKIDRLGAGDKCKITVWVKPLKEGC |
Tag | N-terminal His tag |
Buffer | Tris-based buffer, 50% glycerol. |
Availability | Shipped within 2-3 months. |
Note | This product is for research use only. Not for human consumption, cosmetic, therapeutic or diagnostic use. |