Macrophage Migration Inhibitor Factor C-Terminus Protein

REQUEST MORE INFO
Catalogue No: abx260411
Price: US$261.00
(Size: 5 µg)

Click on the image to see the image legend

Available Options

* Size:



Add to Shopping Cart Buy It Now GET A QUOTE

Documents

Datasheet SDS
Macrophage Migration Inhibitor Factor, His Tag C-Terminus Protein is a recombinant cytokine.

Target MIF C
Origin Human
Expression Recombinant
Tested Applications SDS-PAGE
Conjugation Unconjugated
Form Lyophilized
Purity > 95% (SDS-PAGE and RP-HPLC)
UniProt Primary AC P14174 (UniProt, ExPASy)
UniProt Secondary AC A5Z1R8, B2R4S3, Q2V4Y5, Q6FHV0
UniProt Entry Name MIF_HUMAN
KEGG hsa:4282
String 9606.ENSP00000215754
Sequence MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFALEHHHHHH.
Tag His tag
Availability Shipped within 5-10 working days.
Note This product is for research use only.

Not for human consumption, cosmetic, therapeutic or diagnostic use.
Research Articles on MIF C


Write a review