+44 (0) 1223 755950
+1 832 327 7413
Click on the image to see the image legend
Target | MIF C |
Origin | Human |
Expression | Recombinant |
Tested Applications | SDS-PAGE |
Conjugation | Unconjugated |
Form | Lyophilized |
Purity | > 95% (SDS-PAGE and RP-HPLC) |
UniProt Primary AC | P14174 (UniProt, ExPASy) |
UniProt Secondary AC | A5Z1R8, B2R4S3, Q2V4Y5, Q6FHV0 |
UniProt Entry Name | MIF_HUMAN |
KEGG | hsa:4282 |
String | 9606.ENSP00000215754 |
Sequence | MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFALEHHHHHH. |
Tag | His tag |
Availability | Shipped within 5-10 working days. |
Note | This product is for research use only. Not for human consumption, cosmetic, therapeutic or diagnostic use. |