+44 (0) 1223 755950
+1 832 327 7413
Click on the image to see the image legend
Target | Major mite allergen Der p 23 |
Expression | Recombinant |
Tested Applications | ELISA, WB |
Host | E. coli |
Form | Lyophilized |
Purity | > 95% (HPLC) |
Reconstitution | Reconstitute with sterile deionized water with or without azide. |
Storage | Store at -20°C to -80°C. Avoid repeated freeze/thaw cycles. |
Molecular Weight | 10.4 kDa |
Sequence Fragment | 91 AA |
Sequence | MASWSHPQFEKGAANDNNNDDPTTIDVKTSTVLPTTVTTKQPDDEFECPTRFGYFADPKDPHKFYICSNWEAVHKDCPGNTRWNEDEETCT |
Tag | N-terminal Strep tag |
Buffer | Prior to lyophilization: 100 mM Tris, 150 mM NaCl, pH 8, preservative- and carrier-free. |
Availability | Shipped within 5-12 working days. |
Note | This product is for research use only. Not for human consumption, cosmetic, therapeutic or diagnostic use. |