Major mite allergen Der p 23 Protein

REQUEST MORE INFO
Catalogue No: abx060083
Price: US$725.00
(Size: 0.1 mg)

Click on the image to see the image legend

Available Options

* Size:

Add to Shopping Cart Buy It Now GET A QUOTE

Documents

Datasheet SDS
Major mite allergen Der p 23 Protein is a recombinant protein expressed in E. coli from Dermatophagoides pteronyssinus (European house dust mite).

Target Major mite allergen Der p 23
Expression Recombinant
Tested Applications ELISA, WB
Host E. coli
Form Lyophilized
Purity > 95% (HPLC)
Reconstitution Reconstitute with sterile deionized water with or without azide.
Storage Store at -20°C to -80°C. Avoid repeated freeze/thaw cycles.
Molecular Weight 10.4 kDa
Sequence Fragment 91 AA
Sequence MASWSHPQFEKGAANDNNNDDPTTIDVKTSTVLPTTVTTKQPDDEFECPTRFGYFADPKDPHKFYICSNWEAVHKDCPGNTRWNEDEETCT
Tag N-terminal Strep tag
Buffer Prior to lyophilization: 100 mM Tris, 150 mM NaCl, pH 8, preservative- and carrier-free.
Availability Shipped within 5-12 working days.
Note This product is for research use only.

Not for human consumption, cosmetic, therapeutic or diagnostic use.
Research Articles on Major mite allergen Der p 23


Write a review