+44 (0) 1223 755950
+1 832 327 7413
Monocyte Chemotactic Protein-4 (CCL13) Protein
REQUEST MORE INFO
Catalogue No: abx260335
Price:
US$203.00
(Size: 2 µg)
Reviews: 
(0 Publications and Reviews)
(0 Publications and Reviews)
Click on the image to see the image legend
Human Monocyte Chemotactic Protein-4 (CCL13) Protein is a recombinant chemokine.
Research Articles on MCP 4
| Target | MCP 4 |
| Origin | Human |
| Expression | Recombinant |
| Tested Applications | SDS-PAGE |
| Host | E. coli |
| Conjugation | Unconjugated |
| Form | Lyophilized |
| Purity | > 96% (SDS-PAGE and RP-HPLC) |
| Reconstitution | It is recommended to reconstitute the lyophilized MCP-4 in sterile 18M-cm H2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions. |
| Storage | MCP-4 should be stored desiccated below -18 °C. Upon reconstitution MCP-4 should be stored at 4 °C between 2-7 days and for future use below -18 °C. Avoid repeated freeze/thaw cycles. |
| UniProt Primary AC | Q99616 (UniProt, ExPASy) |
| UniProt Secondary AC | O95689, Q6ICQ6 |
| UniProt Entry Name | CCL13_HUMAN |
| KEGG | hsa:6357 |
| String | 9606.ENSP00000225844 |
| Sequence | QPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT. |
| Biological Activity | The specific activity as determined by the ability of MCP-4 to chemoattaract human monocytes at 1-1ng/ml, corresponding to a Specific Activity of 1,-1, units/mg. |
| Availability | Shipped within 5-10 working days. |
| Note | This product is for research use only. Not for human consumption, cosmetic, therapeutic or diagnostic use. |