+44 (0) 1223 755950
+1 832 327 7413
Click on the image to see the image legend
Target | Ag85B |
Expression | Recombinant |
Tested Applications | SDS-PAGE |
Conjugation | Unconjugated |
Form | Lyophilized |
Purity | > 90% (SDS-PAGE) |
UniProt Primary AC | P9WQP1 (UniProt, ExPASy) |
UniProt Entry Name | A85B_MYCTU |
KEGG | mtc:MT1934 mtu:Rv1886c mtv:RVBD_1886c |
String | 83332.Rv1886c |
Sequence | MRGSHHHHHHFSRPGLPVEYLQVPSPSMGRDIKVQFQSGGNNSPAVYLLDGLRAQDDYNGWDINTPAFEWYYQSGLSIVMPVGGQSSFYSDWYSPACGKAGCQTYKWETFLTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAYHPQQFIYAGSLSALLDPSQGMGPSLIGLAMGDAGGYKAADMWGPSSDPAWERNDPTQQIPKLVANNTRLWVYCGNGTPNELGGANIPAEFLENFVRSSNLKFQDAYNAAGGHNAVFNFPPNGTHSWEYWGAQLNAMKGDLQSSLGAG. |
Activity | Not tested |
Availability | Shipped within 5-10 working days. |
Note | This product is for research use only. Not for human consumption, cosmetic, therapeutic or diagnostic use. |