p23 Protein

REQUEST MORE INFO
Catalogue No: abx675033
Price: US$507.50
(Size: 50 µg)

Click on the image to see the image legend

Available Options

* Size:


Add to Shopping Cart Buy It Now GET A QUOTE

Documents

Datasheet SDS
p23 Protein is a protein produced in Human.

Target p23
Origin Human
Expression Recombinant
Tested Applications WB, SDS-PAGE
Host E. coli
Purity > 90%
Purification Purified by affinity chromatography.
Storage Store at -20°C.
UniProt Primary AC Q15185 (UniProt, ExPASy)
UniProt Secondary AC A8K7D0, B4DHP2, B4DP11, B4DP21, Q8WU70
UniProt Entry Name TEBP_HUMAN
GeneID 10728
NCBI Accession NP_006592.3
KEGG hsa:10728
String 9606.ENSP00000482075
Molecular Weight 23 kDa
Sequence SHMQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE
Buffer 20 mM HEPES buffer pH7.2, 80 mM NaCl, 10% glycerol.
Availability Shipped within 5-12 working days.
Note This product is for research use only.

Not for human consumption, cosmetic, therapeutic or diagnostic use.
Research Articles on p23


Write a review