+44 (0) 1223 755950
+1 832 327 7413
Click on the image to see the image legend
Target | p23 |
Origin | Human |
Expression | Recombinant |
Tested Applications | WB, SDS-PAGE |
Host | E. coli |
Purity | > 90% |
Purification | Purified by affinity chromatography. |
Storage | Store at -20°C. |
UniProt Primary AC | Q15185 (UniProt, ExPASy) |
UniProt Secondary AC | A8K7D0, B4DHP2, B4DP11, B4DP21, Q8WU70 |
UniProt Entry Name | TEBP_HUMAN |
GeneID | 10728 |
NCBI Accession | NP_006592.3 |
KEGG | hsa:10728 |
String | 9606.ENSP00000482075 |
Molecular Weight | 23 kDa |
Sequence | SHMQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE |
Buffer | 20 mM HEPES buffer pH7.2, 80 mM NaCl, 10% glycerol. |
Availability | Shipped within 5-12 working days. |
Note | This product is for research use only. Not for human consumption, cosmetic, therapeutic or diagnostic use. |