+44 (0) 1223 755950
+1 832 327 7413
Click on the image to see the image legend
Target | Scavenger Receptor Class D Member 1 (SCARD1) |
Clonality | Polyclonal |
Reactivity | Mouse |
Tested Applications | WB, IHC, IF/ICC |
Host | Rabbit |
Recommended dilutions | WB: 0.5-2 µg/ml, IHC: 5-20 µg/ml, IF/ICC: 5-20 µg/ml. Optimal dilutions/concentrations should be determined by the end user. |
Conjugation | Unconjugated |
Immunogen | SCARD1 (Ala27-Pro282+TCLSHFLMDSLPLDSNRTYIRARVQSTWTTWRWNTMCPSHRQHSGHSWRRIHLFESSKLPWAKASAVEMQA) |
Form | Liquid |
Purification | Purified by antigen-specific affinity chromatography, followed by Protein A affinity chromatography. |
Storage | Aliquot and store at -20°C. Avoid repeated freeze/thaw cycles. |
Buffer | 0.01 M PBS, pH 7.4, containing 0.05% Proclin-300, 50% glycerol. |
Concentration | 1 mg/ml |
Availability | Shipped within 5-7 working days. |
Note | This product is for research use only. |