Scavenger Receptor Class D Member 1 (SCARD1) Antibody

REQUEST MORE INFO
Catalogue No: abx129743
US$304.50 US$213.15
(Size: 100 µl)

Click on the image to see the image legend

Available Options

* Size:



Add to Shopping Cart Buy It Now GET A QUOTE

Documents

Datasheet SDS
Scavenger Receptor Class D Member 1 Antibody is a Rabbit Polyclonal against Scavenger Receptor Class D Member 1.

Target Scavenger Receptor Class D Member 1 (SCARD1)
Clonality Polyclonal
Reactivity Mouse
Tested Applications WB, IHC, IF/ICC
Host Rabbit
Recommended dilutions WB: 0.5-2 µg/ml, IHC: 5-20 µg/ml, IF/ICC: 5-20 µg/ml. Optimal dilutions/concentrations should be determined by the end user.
Conjugation Unconjugated
Immunogen SCARD1 (Ala27-Pro282+TCLSHFLMDSLPLDSNRTYIRARVQSTWTTWRWNTMCPSHRQHSGHSWRRIHLFESSKLPWAKASAVEMQA)
Form Liquid
Purification Purified by antigen-specific affinity chromatography, followed by Protein A affinity chromatography.
Storage Aliquot and store at -20°C. Avoid repeated freeze/thaw cycles.
Buffer 0.01 M PBS, pH 7.4, containing 0.05% Proclin-300, 50% glycerol.
Concentration 1 mg/ml
Availability Shipped within 5-7 working days.
Note This product is for research use only.
Research Articles on Scavenger Receptor Class D Member 1 (SCARD1)


Write a review