+44 (0) 1223 755950
+1 832 327 7413
Click on the image to see the image legend
Target | Small Ubiquitin Related Modifier Protein 2 (SUMO2) |
Expression | Recombinant |
Tested Applications | SDS-PAGE |
Conjugation | Unconjugated |
Form | Liquid |
Purity | > 95% (SDS-PAGE) |
UniProt Primary AC | P61956 (UniProt, ExPASy) |
UniProt Secondary AC | B2R4I2, P55855, Q32Q42, Q6IPZ6, Q96HK1 |
KEGG | hsa:6613 |
Sequence | MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG. |
Activity | Not tested |
Availability | Shipped within 5-10 working days. |
Note | This product is for research use only. Not for human consumption, cosmetic, therapeutic or diagnostic use. |