Sulfonylurea Receptor 2 (SUR2A) Antibody

REQUEST MORE INFO
Catalogue No: abx445042
Price: US$638.00
(Size: 100 µg)

Click on the image to see the image legend

Available Options

* Size:

Add to Shopping Cart Buy It Now GET A QUOTE

Documents

Datasheet SDS
SUR2A Antibody is a Mouse Monoclonal antibody against SUR2A.

Target Sulfonylurea Receptor 2 (SUR2A)
Clonality Monoclonal
Reactivity Human, Mouse, Rat
Tested Applications WB, IHC, IF/ICC
Host Mouse
Recommended dilutions WB: 1/1000. Optimal dilutions/concentrations should be determined by the end user.
Conjugation Unconjugated
Immunogen Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A.
Isotype IgG2a
Purification Purified by Protein G.
Storage Aliquot and store at -20°C. Avoid repeated freeze/thaw cycles.
UniProt Primary AC P70170 (UniProt, ExPASy)
UniProt Secondary AC O08902, O08920, P70171
UniProt Entry Name ABCC9_MOUSE
GeneID 20928
NCBI Accession NP_001038185.1
KEGG mmu:20928
String 10090.ENSMUSP00000084805
Buffer PBS, pH 7.4, 50% glycerol, 0.1% sodium azide.
Specificity Detects ~120kDa. Does not cross-react with SUR2B.
Concentration 1 mg/ml
Availability Shipped within 5-12 working days.
Note This product is for research use only.
Research Articles on Sulfonylurea Receptor 2 (SUR2A)


Write a review