Human Thymus Activation Regulated Chemokine (TARC) Protein

REQUEST MORE INFO
Catalogue No: abx261547
Price: US$261.00
(Size: 5 µg)

Click on the image to see the image legend

Available Options

* Size:



Add to Shopping Cart Buy It Now GET A QUOTE

Documents

Datasheet SDS
Human Thymus and Activation Regulated Chemokine (CCL17) Protein is a recombinant chemokine.

Target TARC
Origin Human
Expression Recombinant
Tested Applications SDS-PAGE
Host E. coli
Conjugation Unconjugated
Form Lyophilized
Purity > 97% (SDS-PAGE and RP-HPLC)
Reconstitution It is recommended to reconstitute the lyophilized CCL17 in sterile 18MΩ-cm H2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.
Storage TARC should be stored desiccated below -18 °C. Upon reconstitution TARC should be stored at 4 °C between 2-7 days and for future use below -18 °C. Avoid repeated freeze/thaw cycles.
UniProt Primary AC Q92583 (UniProt, ExPASy)
UniProt Secondary AC A0N0Q9, Q2M287
UniProt Entry Name CCL17_HUMAN
KEGG hsa:6361
String 9606.ENSP00000219244
Sequence ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNK RVKNAVKYLQSLERS.
Biological Activity Determined by its ability to chemoattract human T-Lymphocytes using a concentration range of 1.-1. ng/ml corresponding to a Specific Activity of 1,-1,,IU/mg.
Availability Shipped within 5-10 working days.
Note This product is for research use only.

Not for human consumption, cosmetic, therapeutic or diagnostic use.
Research Articles on TARC


Write a review

Tags:
(Click to show)