+44 (0) 1223 755950
+1 832 327 7413
Click on the image to see the image legend
Target | TARC |
Origin | Human |
Expression | Recombinant |
Tested Applications | SDS-PAGE |
Host | E. coli |
Conjugation | Unconjugated |
Form | Lyophilized |
Purity | > 97% (SDS-PAGE and RP-HPLC) |
Reconstitution | It is recommended to reconstitute the lyophilized CCL17 in sterile 18MΩ-cm H2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions. |
Storage | TARC should be stored desiccated below -18 °C. Upon reconstitution TARC should be stored at 4 °C between 2-7 days and for future use below -18 °C. Avoid repeated freeze/thaw cycles. |
UniProt Primary AC | Q92583 (UniProt, ExPASy) |
UniProt Secondary AC | A0N0Q9, Q2M287 |
UniProt Entry Name | CCL17_HUMAN |
KEGG | hsa:6361 |
String | 9606.ENSP00000219244 |
Sequence | ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNK RVKNAVKYLQSLERS. |
Biological Activity | Determined by its ability to chemoattract human T-Lymphocytes using a concentration range of 1.-1. ng/ml corresponding to a Specific Activity of 1,-1,,IU/mg. |
Availability | Shipped within 5-10 working days. |
Note | This product is for research use only. Not for human consumption, cosmetic, therapeutic or diagnostic use. |