+44 (0) 1223 755950
+1 832 327 7413
Click on the image to see the image legend
Target | TGF b 2 |
Origin | Human |
Expression | Recombinant |
Tested Applications | SDS-PAGE |
Conjugation | Unconjugated |
Form | Lyophilized |
Purity | > 97% (SDS-PAGE) |
UniProt Primary AC | P61812 (UniProt, ExPASy) |
UniProt Secondary AC | B4DKC5, P08112, Q15579, Q15581, Q4VAV9 |
UniProt Entry Name | TGFB2_HUMAN |
KEGG | hsa:7042 |
String | 9606.ENSP00000355896 |
Sequence | HHHHHHALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTI LYYIGKTPKIEQLSNMIVKSCKCS. |
Availability | Shipped within 5-10 working days. |
Note | This product is for research use only. Not for human consumption, cosmetic, therapeutic or diagnostic use. |