+44 (0) 1223 755950
+1 832 327 7413
Click on the image to see the image legend
Target | VEGI |
Origin | Human |
Expression | Recombinant |
Tested Applications | SDS-PAGE |
Conjugation | Unconjugated |
Form | Lyophilized |
Purity | > 95% (SDS-PAGE and RP-HPLC) |
UniProt Primary AC | O95150 (UniProt, ExPASy) |
UniProt Secondary AC | Q3SX69, Q5VJK8, Q5VWH1, Q8NFE9 |
Sequence | MQLTKGRLHFSHPLSHTKHISPFVTDAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL. |
Availability | Shipped within 5-10 working days. |
Note | This product is for research use only. Not for human consumption, cosmetic, therapeutic or diagnostic use. |