Human Vascular Endothelial Growth Factor C (VEGFC) Protein

REQUEST MORE INFO
Catalogue No: abx262066
Price: US$261.00
(Size: 5 µg)

Click on the image to see the image legend

Available Options

* Size:



Add to Shopping Cart Buy It Now GET A QUOTE

Documents

Datasheet SDS
VEGFC Protein is a recombinant protein produced by transfected human cells (HEK293 cells) is a single polypeptide chain containing 204 amino acids (32-227). VEGFC is fused to an 8 amino acid His-tag at C-terminus nad purified by proprietary chromatographic techniques.

Target Vascular Endothelial Growth Factor C (VEGFC)
Origin Human
Expression Recombinant
Tested Applications SDS-PAGE
Host Human
Conjugation Unconjugated
Form Lyophilized
Purity > 95% (SDS-PAGE)
UniProt Primary AC P49767 (UniProt, ExPASy)
UniProt Secondary AC B2R9Q8
UniProt Entry Name VEGFC_HUMAN
KEGG hsa:7424
String 9606.ENSP00000480043
Sequence FESGLDLSDAEPDAGEATAYASKDLEEQLRSVSSVDELMTVLYPEYWKMYKCQLRKGGWQHNREQANLNSRTEETIKFAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRRVDHHHHHH
Activity Not tested
Availability Shipped within 5-10 working days.
Note This product is for research use only.

Not for human consumption, cosmetic, therapeutic or diagnostic use.
Research Articles on Vascular Endothelial Growth Factor C (VEGFC)


Write a review

Tags:
(Click to show)