Human Matrix Metalloproteinase 9 (MMP9) Protein

REQUEST MORE INFO
Catalogue No: abx073656
Price: US$261.00
(Size: 2 µg)

Click on the image to see the image legend

Available Options

* Size:



Add to Shopping Cart Buy It Now GET A QUOTE

Documents

Datasheet SDS
Matrix Metalloproteinase-9 is a recombinant enzyme.

Target Matrix Metalloproteinase 9 (MMP9)
Origin Human
Expression Recombinant
Tested Applications SDS-PAGE
Host E. coli
Recommended dilutions Optimal dilutions/concentrations should be determined by the end user.
Form Liquid
Purity > 95% (SDS-PAGE)
Storage Store at 4 °C if the entire vial will be used within 2-4 weeks. Store at -20 °C for long term storage. Avoid repeated freeze/thaw cycles.
UniProt Primary AC P14780 (UniProt, ExPASy)
UniProt Secondary AC B2R7V9, Q3LR70, Q8N725, Q9H4Z1, Q9UCJ9, Q9UCL1, Q9UDK2
UniProt Entry Name MMP9_HUMAN
KEGG hsa:4318
String 9606.ENSP00000361405
Sequence DLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTRDGNADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYSTCTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYGP.
Activity Not tested
Availability Shipped within 5-10 working days.
Note This product is for research use only.

Not for human consumption, cosmetic, therapeutic or diagnostic use.
Research Articles on Matrix Metalloproteinase 9 (MMP9)


Write a review