+44 (0) 1223 755950
+1 832 327 7413
Click on the image to see the image legend
Target | Matrix Metalloproteinase 9 (MMP9) |
Origin | Human |
Expression | Recombinant |
Tested Applications | SDS-PAGE |
Host | E. coli |
Recommended dilutions | Optimal dilutions/concentrations should be determined by the end user. |
Form | Liquid |
Purity | > 95% (SDS-PAGE) |
Storage | Store at 4 °C if the entire vial will be used within 2-4 weeks. Store at -20 °C for long term storage. Avoid repeated freeze/thaw cycles. |
UniProt Primary AC | P14780 (UniProt, ExPASy) |
UniProt Secondary AC | B2R7V9, Q3LR70, Q8N725, Q9H4Z1, Q9UCJ9, Q9UCL1, Q9UDK2 |
UniProt Entry Name | MMP9_HUMAN |
KEGG | hsa:4318 |
String | 9606.ENSP00000361405 |
Sequence | DLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTRDGNADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYSTCTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYGP. |
Activity | Not tested |
Availability | Shipped within 5-10 working days. |
Note | This product is for research use only. Not for human consumption, cosmetic, therapeutic or diagnostic use. |