+44 (0) 1223 755950
+1 832 327 7413
Human C-X-C Motif Chemokine 9 (CXCL9) Protein
REQUEST MORE INFO
Catalogue No: abx261586
Price:
US$261.00
(Size: 5 µg)
Reviews: 
(0 Publications and Reviews)
(0 Publications and Reviews)
Click on the image to see the image legend
Human MIG (CXCL9) Protein is a recombinant chemokine.
Research Articles on MIG
| Target | MIG |
| Origin | Human |
| Expression | Recombinant |
| Tested Applications | SDS-PAGE |
| Host | E. coli |
| Conjugation | Unconjugated |
| Form | Lyophilized |
| Purity | > 97% (SDS-PAGE and RP-HPLC) |
| Reconstitution | It is recommended to reconstitute the lyophilized MIG in sterile 18MΩ-cm H2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions. |
| Storage | MIG should be stored desiccated below -18 °C. Upon reconstitution CXCL9 should be stored at 4 °C between 2-7 days and for future use below -18 °C. Avoid repeated freeze/thaw cycles. |
| UniProt Primary AC | Q07325 (UniProt, ExPASy) |
| UniProt Secondary AC | Q503B4 |
| UniProt Entry Name | CXCL9_HUMAN |
| KEGG | hsa:4283 |
| String | 9606.ENSP00000354901 |
| Sequence | TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT. |
| Biological Activity | Determined by its ability to chemoattract human peripheral blood T-Lymphocytes using a concentration range of 1-1ng/ml corresponding to a Specific Activity of 1,-1,IU/mg. |
| Availability | Shipped within 5-10 working days. |
| Note | This product is for research use only. Not for human consumption, cosmetic, therapeutic or diagnostic use. |